Zinc Finger Protein 558 (ZNF558) (N-Term) antibody

Details for Product No. ABIN183846
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
(3), (2), (1), (1), (1)
Reactivity
Human
(8)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183846
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF558
Sequence AAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVA VEFTQEEWAL
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF558. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF558
Background ZNF588 contains 1 KRAB domain and 9 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 46 kDa
Gene ID 148156
NCBI Accession NM_144693, NP_653294
UniProt Q96NG5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 402 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 558 (ZNF558) (N-Term) antibody WB Suggested Anti-ZNF558 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Hosts (8), (1)
Reactivities (8)
Applications (8), (1), (1), (1)
Epitopes (3), (2), (1), (1), (1)
back to top