Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 558 (ZNF558) (N-Term) antibody

Details for Product No. ABIN183846
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(7), (6), (3), (2), (1), (1)
Reactivity
Human
(14)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (7), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183846
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF558
Sequence AAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVA VEFTQEEWAL
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF558. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF558
Background ZNF588 contains 1 KRAB domain and 9 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 46 kDa
Gene ID 148156
NCBI Accession NM_144693, NP_653294
UniProt Q96NG5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 402 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 558 (ZNF558) (N-Term) antibody WB Suggested Anti-ZNF558 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Hosts (14), (1)
Reactivities (14)
Applications (14), (7), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183846
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top