Zinc Finger Protein 558 (ZNF558) antibody

Antigen: Zinc Finger Protein 558 (ZNF558)

Synonyms: FLJ30932

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN183846

Additional Information

Alternative name: ZNF558

Gene ID: ZNF558

UniProt: Q96NG5

Immunogen: The immunogen for anti-ZNF558 antibody: synthetic peptide directed towards the N terminal of human ZNF558

Sequence: AAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVA VEFTQEEWAL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF558 antibody concentration is 1 mg/ml.

Description: ZNF588 contains 1 KRAB domain and 9 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Characteristics: Antigen Size: 402 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-ZNF558 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF558 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).