High Mobility Group Box 4 (HMGB4) antibody

Antigen: High Mobility Group Box 4 (HMGB4)

Synonyms: AI326135, MGC107306, 1700001F22Rik, RP23-284L15.1, FLJ40388, MGC88128, dJ1007G16.5, HMGB4, MGC133486

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN183849

Additional Information

Alternative name: HMGB4

Gene ID: HMGB4

UniProt: Q8WW32

Immunogen: The immunogen for anti-HMGB4 antibody: synthetic peptide directed towards the C terminal of human HMGB4

Sequence: WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKY RMSARNRCRG

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HMGB4 antibody concentration is 1 mg/ml.

Description: HMGB4 contains two HMG-box regions, which is found in a variety of eukaryotic chromosomal proteins and transcription.

Characteristics: Antigen Size: 186 amino acids

Molecular Weight: 22kDa

Application Details

Application Notes: WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).