Aprataxin (APTX) antibody

Antigen: Aprataxin (APTX)

Synonyms: AOA, AOA1, AXA1, EAOH, EOAHA, FHA-HIT, MGC1072, FLJ20157, AA388047, 2410016G21Rik, APTX, MGC133769, aptx, MGC131296, LOC100284636, APRATAXIN-like, T10O8.20, T10O8_20

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Chicken, Dog (Canine), Xenopus laevis

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183871

Additional Information

Alternative name: Aprataxin

Gene ID: APTX

UniProt: Q6JV85

Immunogen: The immunogen for anti-APTX antibody: synthetic peptide directed towards the C terminal of human APTX

Sequence: VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQL KEHLRKHWTQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-APTX antibody concentration is 1 mg/ml.

Description: APTX is a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. APTX may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.This gene encodes a member of the histidine triad (HIT) superfamily, some of which have nucleotide-binding and diadenosine polyphosphate hydrolase activities. The encoded protein may play a role in single-stranded DNA repair. Mutations in this gene have been associated with ataxia-ocular apraxia. Multiple transcript variants encoding distinct isoforms have been identified for this gene, however, the full length nature of some variants has not been determined.

Characteristics: Antigen Size: 342 amino acids

Molecular Weight: 38kDa

Application Details

Application Notes: WB Suggested Anti-APTX Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-APTX Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysate

anti-Aprataxin (APTX) antibody (Image 2)

Publications

Product: Ahnesorg, Smith, Jackson: "XLF interacts with the XRCC4-DNA ligase IV complex to promote DNA nonhomologous end-joining." in: Cell, Vol. 124, Issue 2, pp. 301-13, 2006 (PubMed).