Exosome Component 3 (EXOSC3) antibody
| Antigen | Exosome Component 3 (EXOSC3) |
| Synonyms | p10, RRP40, MGC723, Rrp40p, CGI-102, hRrp-40, hRrp40p, MGC15120, bA3J10.7, RP11-3J10.8, Rrp40, AI593501, 2310005D06Rik, EXOSC3, MGC127537, MGC112345, im:7140537, zgc:112345, MGC84934 |
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
![]() |
1 reference available |
| Catalog no. | ABIN183904 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | EXOSC3 |
| Gene ID | EXOSC3 |
| UniProt | Q9NQT5 |
| Immunogen | The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the middle region of human EXOSC3 |
| Sequence | TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGI VTAKSGDIFK |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-EXOSC3 antibody concentration is 1 mg/ml. |
| Description | EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. |
| Characteristics | Antigen Size: 275 amino acids |
| Molecular Weight | 30kDa |
Application Details
| Application Notes |
WB Suggested Anti-EXOSC3 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Chromatin and Nuclear Signaling, DNA/RNA |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-EXOSC3 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate anti-Exosome Component 3 (EXOSC3) antibody (Image 2) |
Publications
| Product |
Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).
|
Alternatives
Alternatives for antigen "Exosome Component 3 (EXOSC3)", type "Antibodies"
| Hosts | Rabbit (17), Mouse (6) |
| Reactivities | Human (20), Mouse (Murine) (6), Rat (Rattus) (6), Cow (Bovine) (3), Dog (Canine) (3), Cat (Feline) (1), Chicken (1), Xenopus laevis (1), Zebrafish (1) |
| Applications | Western Blotting (WB) (23), ELISA (12), Immunohistochemistry (IHC) (11), Flow Cytometry (FACS) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1) |
| Epitopes | C-Term (5), Internal Region (1) |




Alternatives