Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Neuro-Oncological Ventral Antigen 2 (NOVA2) antibody

Antigen

Neuro-Oncological Ventral Antigen 2 (NOVA2)

Synonyms ANOVA, NOVA3, Gm1424, NOVA2, nova1a, anova, nova3, MGC97842
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Zebrafish, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183949
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name NOVA2
Gene ID NOVA2
UniProt Q9UNW9
Immunogen The immunogen for anti-NOVA2 antibody: synthetic peptide directed towards the N terminal of human NOVA2
Sequence MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIP SYAAGSIIGK
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-NOVA2 antibody concentration is 1 mg/ml.
Description NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.
Characteristics Antigen Size: 492 amino acids
Molecular Weight 54kDa

Application Details

Application Notes WB Suggested Anti-NOVA2 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Lewis, Musunuru, Jensen et al.: "Sequence-specific RNA binding by a Nova KH domain: implications for paraneoplastic disease and the fragile X syndrome." in: Cell, Vol. 100, Issue 3, pp. 323-32, 2000 (PubMed).

Alternatives

Alternatives for antigen "Neuro-Oncological Ventral Antigen 2 (NOVA2)", type "Antibodies"
Hosts Rabbit (28)
Reactivities Human (26), Mouse (Murine) (22), Rat (Rattus) (22), Dog (Canine) (20), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Xenopus laevis (1), Zebrafish (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (13), ELISA (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes AA 15-31 (1), Internal Region (1), N-Term (1)