Neuro-Oncological Ventral Antigen 2 (NOVA2) (Middle Region) antibody

Details for Product No. ABIN183950
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms nova1, ANOVA, NOVA3, Gm1424, nova1a, NOVA2, anova, nova3, MGC97842
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human
(22), (17), (16), (13), (12), (1), (1)
Host
Rabbit
(23), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (10), (6), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183950
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NOVA2
Sequence EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANS NPTGSPYASP
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against NOVA2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name NOVA2
Background NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.
Molecular Weight 54 kDa
Gene ID 4858
NCBI Accession NM_002516, NP_002507
UniProt Q9UNW9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 492 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Neuro-Oncological Ventral Antigen 2 (NOVA2) (Middle Region) antibody WB Suggested Anti-NOVA2 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Background publications Lewis, Musunuru, Jensen et al.: "Sequence-specific RNA binding by a Nova KH domain: implications for paraneoplastic disease and the fragile X syndrome." in: Cell, Vol. 100, Issue 3, pp. 323-32, 2000 (PubMed).

Hosts (23), (1)
Reactivities (22), (17), (16), (13), (12), (1), (1)
Applications (15), (10), (6), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1), (1)
back to top