Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183950

Neuro-Oncological Ventral Antigen 2 (NOVA2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms nova1, ANOVA, NOVA3, Gm1424, nova1a, NOVA2, anova, nova3, MGC97842
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183950
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NOVA2 antibody: synthetic peptide directed towards the middle region of human NOVA2
Sequence EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANS NPTGSPYASP
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 91%
Characteristics This is a rabbit polyclonal antibody against NOVA2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name NOVA2
Background NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.
Molecular Weight 54kDa
Gene ID 4858
NCBI Accession NP_002507, NM_002516
UniProt Q9UNW9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NOVA2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lewis, Musunuru, Jensen et al.: "Sequence-specific RNA binding by a Nova KH domain: implications for paraneoplastic disease and the fragile X syndrome." in: Cell, Vol. 100, Issue 3, pp. 323-32, 2000 (PubMed).

Alternatives for antigen "Neuro-Oncological Ventral Antigen 2 (NOVA2)", type "Antibodies"
Hosts (23)
Reactivities (21), (15), (15), (13), (12), (1), (1)
Applications (14), (10), (6), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1)
Beacon