Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183957

Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SMF, Sm-F, snRNP-F, 2010013O18Rik, sm-F, snrpfl, SmF, BcDNA:GM23968, CG16792, Deb, Deb-B, DebB, Dmel\\CG16792, dF, deb-b, sm-f, smf
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Zebrafish (Danio rerio)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183957
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SNRPF antibody: synthetic peptide directed towards the N terminal of human SNRPF
Sequence MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYM NMQLANTEEY
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against SNRPF. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name SNRPF
Background SNRPF belongs to the snRNP Sm proteins family and is associated with snRNP U1, U2, U4/U6 and U5.
Molecular Weight 9kDa
Gene ID 6636
NCBI Accession NP_003086, NM_003095
UniProt P62306
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SNRPF antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pellizzoni, Baccon, Rappsilber et al.: "Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component." in: The Journal of biological chemistry, Vol. 277, Issue 9, pp. 7540-5, 2002 (PubMed).

Alternatives for antigen "Small Nuclear Ribonucleoprotein Polypeptide F (SNRPF)", type "Antibodies"
Hosts (12)
Reactivities (10), (3), (3), (1), (1), (1), (1)
Applications (9), (8), (7)
Epitopes (1), (1), (1)
Beacon