Tyrosyl-tRNA Synthetase (Yars) antibody

Antigen: Tyrosyl-tRNA Synthetase (Yars)

Synonyms: YRS, YTS, TYRRS, CMTDIC, AL024047, AU018965, YARS, MGC139774, MGC112837, cb204, wu:fk52b08, yars, MGC53284, yrs, yts, tyrrs, cmtdic, MGC89487, DKFZp459P229, anon-EST:Posey261, CG4561, DmelCG4561, dYARS, TyrRS, ECK1633, JW1629

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN183962

Additional Information

Alternative name: YARS

Gene ID: YARS

UniProt: P54577

Immunogen: The immunogen for anti-YARS antibody: synthetic peptide directed towards the C terminal of human YARS

Sequence: QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEK LQADFKISEE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-YARS antibody concentration is 1 mg/ml.

Description: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.

Characteristics: Antigen Size: 528 amino acids

Molecular Weight: 58kDa

Synonyms: YRS, YTS, TYRRS, CMTDIC, AL024047, AU018965, YARS, MGC139774, MGC112837, cb204, wu:fk52b08, yars, MGC53284, yrs, yts, tyrrs, cmtdic, MGC89487, DKFZp459P229, anon-EST:Posey261, CG4561, DmelCG4561, dYARS, TyrRS, ECK1633, JW1629

Application Details

Application Notes: WB Suggested Anti-YARS Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-YARS Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Jordanova, Irobi, Thomas et al.: "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy." in: Nature genetics, Vol. 38, Issue 2, pp. 197-202, 2006 (PubMed).