Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) antibody

Antigen: Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1)

Synonyms: STAU, FLJ25010, fi67e05, zgc:77271, wu:fi67e05, STAU1, DKFZp459A0124, CG5753, DmelCG5753, Dmstau, dStau, Stau, Stauf, stau, XStau, XStau1, Staufen, Staufen1, MGC145034

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183977

Additional Information

Alternative name: STAU / STAU1

Gene ID: STAU1

UniProt: O95793

Immunogen: The immunogen for anti-STAU1 antibody: synthetic peptide directed towards the N terminal of human STAU1

Sequence: LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLE VNGRESEEEN

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-STAU1 antibody concentration is 1 mg/ml.

Description: STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.

Characteristics: Antigen Size: 577 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-STAU1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-STAU1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

anti-Staufen, RNA Binding Protein, Homolog 1 (Drosophila) (STAU1) antibody (Image 2)

Publications

Product: Kim, Furic, Desgroseillers et al.: "Mammalian Staufen1 recruits Upf1 to specific mRNA 3'UTRs so as to elicit mRNA decay." in: Cell, Vol. 120, Issue 2, pp. 195-208, 2005 (PubMed).