Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (Yeast) (RRP9) antibody

Antigen: Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (Yeast) (RRP9)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN183979

Additional Information

Alternative name: RNU3IP2 / RRP9

Gene ID: RRP9

UniProt: O43818

Immunogen: The immunogen for anti-RRP9 antibody: synthetic peptide directed towards the middle region of human RRP9

Sequence: IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLI LIWEAQSCQH

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-RRP9 antibody concentration is 1 mg/ml.

Description: RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.

Characteristics: Antigen Size: 475 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-RRP9 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RRP9 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Verheggen, Lafontaine, Samarsky et al.: "Mammalian and yeast U3 snoRNPs are matured in specific and related nuclear compartments." in: The EMBO journal, Vol. 21, Issue 11, pp. 2736-45, 2002 (PubMed).