Cold Shock Domain Containing C2, RNA Binding (CSDC2) antibody
| Antigen | Cold Shock Domain Containing C2, RNA Binding (CSDC2) |
| Synonyms | CSDC2, pippin, zgc:91826 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN184032 |
| Quantity | 0.1 mg |
| Price | 251.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | CSDC2 |
| Gene ID | CSDC2 |
| UniProt | Q9Y534 |
| Immunogen | The immunogen for anti-CSDC2 antibody: synthetic peptide directed towards the N terminal of human CSDC2 |
| Sequence | MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGV PPRDLPSPLP |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 100 µl of distilled water. Final anti-CSDC2 antibody concentration is 1 mg/ml. |
| Description | CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain. |
| Characteristics | Antigen Size: 153 amino acids |
| Molecular Weight | 17kDa |
Application Details
| Application Notes |
WB Suggested Anti-CSDC2 Antibody Titration: 0.625ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate. |
| Purification | Protein A purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-CSDC2 Antibody Titration: 0.625ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) antibody (Image 2) |
Publications
| Product |
Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).
|
Alternatives
Alternatives for antigen "Cold Shock Domain Containing C2, RNA Binding (CSDC2)", type "Antibodies"
| Hosts | Rabbit (22), Mouse (2) |
| Reactivities | Human (22), Mouse (Murine) (20), Dog (Canine) (18), Rat (Rattus) (18) |
| Applications | Immunofluorescence (IF) (16), Western Blotting (WB) (9), ELISA (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1) |
| Conjugates | Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1) |
| Epitopes | Center (1), Internal Region (1), Middle Region (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
