Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Exosome Component 3 (EXOSC3) antibody

Antigen

Exosome Component 3 (EXOSC3)

Synonyms p10, RRP40, MGC723, Rrp40p, CGI-102, hRrp-40, hRrp40p, MGC15120, bA3J10.7, RP11-3J10.8, Rrp40, AI593501, 2310005D06Rik, EXOSC3, MGC127537, MGC112345, im:7140537, zgc:112345, MGC84934
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN184036
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name EXOSC3
Gene ID EXOSC3
UniProt Q9NQT5
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3
Sequence PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQR KQIFSRLAES
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-EXOSC3 antibody concentration is 1 mg/ml.
Description EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
Characteristics Antigen Size: 275 amino acids
Molecular Weight 30kDa

Application Details

Application Notes WB Suggested Anti-EXOSC3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only

Publications

Product Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives

Alternatives for antigen "Exosome Component 3 (EXOSC3)", type "Antibodies"
Hosts Rabbit (17), Mouse (6)
Reactivities Human (20), Mouse (Murine) (6), Rat (Rattus) (6), Cow (Bovine) (3), Dog (Canine) (3), Xenopus laevis (2), Cat (Feline) (1), Chicken (1), Zebrafish (1)
Applications Western Blotting (WB) (23), ELISA (12), Immunohistochemistry (IHC) (11), Flow Cytometry (FACS) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (5), Internal Region (1)