Exosome Component 4 (EXOSC4) antibody

Antigen: Exosome Component 4 (EXOSC4)

Synonyms: SKI6, p12A, RRP41, Ski6p, RRP41A, Rrp41p, hRrp41p, FLJ20591, Rrp41, 1110039I09Rik, 1500001N04Rik, MGC73175, zgc:73175, EXOSC4

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184050

Additional Information

Alternative name: EXOSC4

Gene ID: EXOSC4

UniProt: Q9NPD3

Immunogen: The immunogen for anti-EXOSC4 antibody: synthetic peptide directed towards the N terminal of human EXOSC4

Sequence: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTK ALAVVYGPHE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-EXOSC4 antibody concentration is 1 mg/ml.

Description: EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.

Characteristics: Antigen Size: 245 amino acids

Molecular Weight: 27kDa

Application Details

Application Notes: WB Suggested Anti-EXOSC4 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-EXOSC4 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

anti-Exosome Component 4 (EXOSC4) antibody (Image 2)

anti-Exosome Component 4 (EXOSC4) antibody (Image 3)

Publications

Product: Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).