Did you know that you can buy products from over 140 different suppliers from us?

Nucleolar Complex Associated 4 Homolog (S. Cerevisiae) (NOC4L) (C-Term) antibody

Details for Product No. ABIN184060
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NOC4L, AI326906, RGD1310661, NET49, NOC4, UTP19
Epitope
C-Term
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(5), (2), (2)
Host
Rabbit
(5), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(6), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN184060
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NOC4L
Sequence CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQA LQRHYHPEVS
Predicted Reactivity Human : 100 %, Bovine : 90 %, Horse : 90 %, Pig : 90 %, Mouse : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against NOC4L. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name NOC4L
Background NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome.
Molecular Weight 57 kDa
Gene ID 79050
NCBI Accession NM_024078, NP_076983
UniProt Q9BVI4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 516 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nucleolar Complex Associated 4 Homolog (S. Cerevisiae) (NOC4L) (C-Term) antibody WB Suggested Anti-NOC4L Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
anti-Nucleolar Complex Associated 4 Homolog (S. Cerevisiae) (NOC4L) (C-Term) antibody (2) anti-Nucleolar Complex Associated 4 Homolog (S. Cerevisiae) (NOC4L) (C-Term) antibody (Image 2)
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184060
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top