Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184060

Nucleolar Complex Associated 4 Homolog (S. Cerevisiae) (NOC4L) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NOC4L, AI326906, RGD1310661, NET49, NOC4, UTP19
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184060
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NOC4L antibody: synthetic peptide directed towards the C terminal of human NOC4L
Sequence CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQA LQRHYHPEVS
Predicted Reactivity Human : 100%, Bovine : 92%, Horse : 92%, Pig : 92%, Mouse : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against NOC4L. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name NOC4L
Background NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome.
Molecular Weight 57kDa
Gene ID 79050
NCBI Accession NP_076983, NM_024078
UniProt Q9BVI4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NOC4L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Nucleolar Complex Associated 4 Homolog (S. Cerevisiae) (NOC4L)", type "Antibodies"
Hosts (5), (1)
Reactivities (5), (2), (2), (1), (1), (1)
Applications (6), (2), (2), (1)
Epitopes (1), (1), (1)
Beacon