Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184061

Apolipoprotein O (APOO) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FAM121B, 0610008C08Rik, 1110019O03Rik, RGD1565289, MGC79016, MGC140415, my025, fam121b, fp74f12, wu:fp74f12, zgc:123314
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN184061
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the C terminal of human FAM121B
Sequence LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKP GNVKNSPGTK
Predicted Reactivity Human :100%,   Mouse :92%,   Bovine :85%,   Rat :78%,  
Characteristics This is a rabbit polyclonal antibody against FAM121B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name FAM121B
Background FAM121B belongs to the FAM121 family and the function remains unknown.
Molecular Weight 22kDa
Gene ID 79135
NCBI Accession NP_077027, NM_024122
UniProt Q9BUR5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM121B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Alternatives for antigen "Apolipoprotein O (APOO)", type "Antibodies"
Hosts (20), (7)
Reactivities (25), (17), (12), (12), (12), (12), (12)
Applications (18), (10), (9), (6), (6)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (1), (1)
Beacon