APOO antibody (C-Term)

Catalog No. ABIN630052

Product Details anti-APOO Antibody

Target: APOO (Apolipoprotein O (APOO))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOO antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM121 B antibody was raised against the C terminal Of Fam121

Purification: Purified

Immunogen: FAM121 B antibody was raised using the C terminal Of Fam121 corresponding to a region with amino acids LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM121B Blocking Peptide, catalog no. 33R-5578, is also available for use as a blocking control in assays to test for specificity of this FAM121B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOO

Target: APOO (Apolipoprotein O (APOO))

Alternative Name: FAM121B (APOO Products)

Synonyms: fam121b antibody, fp74f12 antibody, wu:fp74f12 antibody, zgc:123314 antibody, my025 antibody, FAM121B antibody, 0610008C08Rik antibody, 1110019O03Rik antibody, RGD1565289 antibody, MGC79016 antibody, si:rp71-1f1.3 antibody, wu:fr42a11 antibody, zgc:103766 antibody, apolipoprotein O, a antibody, apolipoprotein O antibody, apolipoprotein O L homeolog antibody, apolipoprotein O, b antibody, apooa antibody, apoo antibody, APOO antibody, Apoo antibody, apoo.L antibody, apoob antibody

Background: FAM121B belongs to the FAM121 family and the function remains unknown.

Molecular Weight: 22 kDa (MW of target protein)