Apolipoprotein O (APOO) antibody

Antigen: Apolipoprotein O (APOO)

Synonyms: MGC130105, MGC130106, 0610008C08Rik, 1110019O03Rik, RP23-272D10.2, RGD1565289, MGC79016, MGC140415, my025, fam121b, My025, FAM121B, MGC4825, fp74f12, wu:fp74f12, MGC123314, zgc:123314

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN184061

Additional Information

Alternative name: Apolipoprotein O (Apo O)

Gene ID: FAM121B

UniProt: Q9BUR5

Immunogen: The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the C terminal of human FAM121B

Sequence: LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKP GNVKNSPGTK

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-FAM121B antibody concentration is 1 mg/ml.

Description: FAM121B belongs to the FAM121 family and the function remains unknown.

Characteristics: Antigen Size: 198 amino acids

Molecular Weight: 22kDa

Application Details

Application Notes: WB Suggested Anti-FAM121B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FAM121B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).