Apolipoprotein O (APOO) (N-Term) antibody

Details for Product No. ABIN184062
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms FAM121B, 0610008C08Rik, 1110019O03Rik, RGD1565289, MGC79016, MGC140415, my025, fam121b, fp74f12, wu:fp74f12, zgc:123314
Epitope
N-Term
(3), (2), (2), (1)
Reactivity
Human
(28), (19), (13), (13), (12), (12), (12)
Host
Rabbit
(21), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (11), (10), (8), (6), (2), (2)
Pubmed 2 references available
Catalog no. ABIN184062
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FAM121B
Sequence PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQS KYVEEARSQL
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against FAM121B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name FAM121B
Background FAM121B belongs to the FAM121 family and the function remains unknown.
Molecular Weight 22 kDa
Gene ID 79135
NCBI Accession NM_024122, NP_077027
UniProt Q9BUR5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 198 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Apolipoprotein O (APOO) (N-Term) antibody WB Suggested Anti-FAM121B Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment...." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

General Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Hosts (21), (9)
Reactivities (28), (19), (13), (13), (12), (12), (12)
Applications (21), (11), (10), (8), (6), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1)
back to top