DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) antibody

Antigen: DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17)

Synonyms: P72, RH70, DKFZp761H2016, p72, Gm926, C80929, AI047725, MGC79147, 2610007K22Rik, A430025E01Rik, MGC109323, MGC80019, Cp68, DDX17, DDX46

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184065

Additional Information

Alternative name: DEAD box protein 17

Gene ID: DDX17

Immunogen: The immunogen for anti-DDX17 antibody: synthetic peptide directed towards the N terminal of human DDX17

Sequence: TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETD RAGYANGSGY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-DDX17 antibody concentration is 1 mg/ml.

Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The DEAD box protein is an ATPase activated by a variety of RNA species but not by dsDNA. This protein and that encoded by DDX5 gene are more closely related to each other than to any other member of the DEAD box family.

Characteristics: Antigen Size: 547 amino acids

Molecular Weight: 60kDa

Application Details

Application Notes: WB Suggested Anti-DDX17 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DDX17 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) antibody (Image 2)

Publications

Product: Venter, Adams, Myers et al.: "The sequence of the human genome." in: Science (New York, N.Y.), Vol. 291, Issue 5507, pp. 1304-51, 2001 (PubMed).