Exosome Component 6 (EXOSC6) (N-Term) antibody

Details for Product No. ABIN184073
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms p11, EAP4, MTR3, Mtr3p, hMtr3p, 2610510N21Rik, C76919, Mtr3, id:ibd1130, wu:fe17d05, zgc:110071, exosc6, RAR-gamma
Epitope
N-Term
(5), (3)
Reactivity
Dog (Canine), Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
(6), (1), (1), (1), (1), (1)
Host
Rabbit
(8)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (2)
Pubmed 1 reference available
Catalog no. ABIN184073
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human EXOSC6
Sequence MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVY ARAGLLSQAK
Predicted Reactivity Bovine : 92 %, Rat : 92 %
Characteristics This is a rabbit polyclonal antibody against EXOSC6. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name EXOSC6
Background EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.
Molecular Weight 30 kDa
Gene ID 118460
NCBI Accession NM_058219, NP_478126
UniProt Q5RKV6
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 272 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exosome Component 6 (EXOSC6) (N-Term) antibody WB Suggested Anti-EXOSC6 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
anti-Exosome Component 6 (EXOSC6) (N-Term) antibody (2) anti-Exosome Component 6 (EXOSC6) (N-Term) antibody (Image 2)
anti-Exosome Component 6 (EXOSC6) (N-Term) antibody (3) anti-Exosome Component 6 (EXOSC6) (N-Term) antibody (Image 3)
Background publications Raijmakers, Egberts, van Venrooij et al.: "Protein-protein interactions between human exosome components support the assembly of RNase PH-type subunits into a six-membered PNPase-like ring." in: Journal of molecular biology, Vol. 323, Issue 4, pp. 653-63, 2002 (PubMed).

Hosts (8)
Reactivities (6), (1), (1), (1), (1), (1)
Applications (8), (2)
Epitopes (5), (3)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top