Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) antibody

Antigen: Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL)

Synonyms: AI256697, AI852082, 2510028H02Rik, 2810036L13Rik, SRRF, hnRNPLL, RGD1305861, HNRPLL, MGC139688, srrf

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184075

Additional Information

Alternative name: HnRNP-L like / HNRPLL

Gene ID: HNRPLL

UniProt: Q8WVV9

Immunogen: The immunogen for anti-HNRPLL antibody: synthetic peptide directed towards the N terminal of human HNRPLL

Sequence: RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQP EAGGSHHKVS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-HNRPLL antibody concentration is 1 mg/ml.

Description: HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.

Characteristics: Antigen Size: 542 amino acids

Molecular Weight: 60kDa

Application Details

Application Notes: WB Suggested Anti-HNRPLL Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HNRPLL Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

anti-Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) antibody (Image 2)

anti-Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL) antibody (Image 3)

Publications

Product: Shur, Ben-Avraham, Benayahu: "Alternatively spliced isoforms of a novel stromal RNA regulating factor." in: Gene, Vol. 334, pp. 113-21, 2004 (PubMed).