Did you know that you can buy products from over 140 different suppliers from us?

Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody

Details for Product No. ABIN184093
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610510D13Rik, D10S102, FBRNP, HNRPA3, 2410013L13Rik, 2610209F03Rik, Hnrpa3, zgc:153703, DKFZp469I0118
Epitope
N-Term
(12), (6), (3)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(12), (1), (1), (1), (1), (1)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(14), (6), (5), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN184093
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HNRPA3
Sequence MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIG GLSFETTDDS
Predicted Reactivity Mouse :100 %,   Rat :100 %,   Bovine :100 %,   Dog :100 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against HNRPA3. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name HNRPA3
Background HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
Molecular Weight 42 kDa
Gene ID 220988
NCBI Accession NM_194247, NP_919223
UniProt P51991
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 378 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody WB Suggested Anti-HNRPA3 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (2) anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (Image 2)
anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (3) anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody (Image 3)
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184093
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top