Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184093

Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610510D13Rik, D10S102, FBRNP, HNRPA3, 2410013L13Rik, 2610209F03Rik, Hnrpa3, zgc:153703, DKFZp469I0118
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN184093
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3
Sequence MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIG GLSFETTDDS
Predicted Reactivity Mouse :100%,   Rat :100%,   Bovine :100%,   Dog :100%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against HNRPA3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name HNRPA3
Background HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
Molecular Weight 42kDa
Gene ID 220988
NCBI Accession NP_919223, NM_194247
UniProt P51991
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HNRPA3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3)", type "Antibodies"
Hosts (8)
Reactivities (6), (1), (1), (1), (1), (1)
Applications (8), (5)
Epitopes (6), (2), (1)
Beacon