Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) antibody

Antigen

Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3)

Synonyms FBRNP, HNRPA3, D10S102, MGC138232, MGC142030, 2610510D13Rik, Hnrpa3, MGC37309, MGC101940, 2410013L13Rik, 2610209F03Rik, HNRNPA3, MGC153703, zgc:153703, DKFZp469I0118
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
2 references available
Catalog no. ABIN184093
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name HnRNP-A3 / HNRNPA3
Gene ID HNRPA3
UniProt P51991
Immunogen The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3
Sequence MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIG GLSFETTDDS
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-HNRPA3 antibody concentration is 1 mg/ml.
Description HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
Characteristics Antigen Size: 378 amino acids
Molecular Weight 42kDa

Application Details

Application Notes WB Suggested Anti-HNRPA3 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Alternatives

Alternatives for antigen "Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3)", type "Antibodies"
Hosts Rabbit (5)
Reactivities Human (3), Cow (Bovine) (1), Dog (Canine) (1), Mouse (Murine) (1), Rat (Rattus) (1), Xenopus laevis (1)
Applications Immunohistochemistry (IHC) (5), Western Blotting (WB) (5)
Epitopes N-Term (2)