Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) antibody

Antigen: Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3)

Synonyms: FBRNP, HNRPA3, D10S102, MGC138232, MGC142030, 2610510D13Rik, Hnrpa3, MGC37309, MGC101940, 2410013L13Rik, 2610209F03Rik, HNRNPA3, MGC153703, zgc:153703, DKFZp469I0118

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184093

Additional Information

Alternative name: HnRNP-A3 / HNRNPA3

Gene ID: HNRPA3

UniProt: P51991

Immunogen: The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3

Sequence: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIG GLSFETTDDS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-HNRPA3 antibody concentration is 1 mg/ml.

Description: HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing

Characteristics: Antigen Size: 378 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-HNRPA3 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HNRPA3 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) antibody (Image 2)

anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) antibody (Image 3)

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).