Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) (C-Term) antibody

Details for Product No. ABIN184114
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DGCRK3, GY2, WDR14, WDVCF, ESTM55, Gm16314, Me49f07, OTTMUSG00000033458, Wdr14, Wdvcf, zgc:110763, GBL, fi37e04, gbl, wu:fi37e04, zgc:55455, zgc:85668, GNB1L
Epitope
C-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Human
(14), (13), (13), (12)
Host
Rabbit
(15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(10), (6), (4), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN184114
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GNB1L
Sequence RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQR ISLWSLYPRA
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against GNB1L. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name GNB1L
Background GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders.
Molecular Weight 36 kDa
Gene ID 54584
NCBI Accession NM_053004, NP_443730
UniProt Q9BYB4
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 327 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) (C-Term) antibody WB Suggested Anti-GNB1L Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate
anti-Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) (C-Term) antibody (2) anti-Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) (C-Term) antibody (Image 2)
anti-Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) (C-Term) antibody (3) anti-Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) (C-Term) antibody (Image 3)
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (15)
Reactivities (14), (13), (13), (12)
Applications (10), (6), (4), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top