Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) antibody

Antigen: Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L)

Synonyms: GY2, FKSG1, WDR14, WDVCF, DGCRK3, KIAA1645, Gbl, AA409454, AI505104, AI851821, 0610033N12Rik, MGC114322, MLST8, GBL, MGC139583, fi37e04, MGC55455, MGC85668, zgc:55455, zgc:85668, wu:fi37e04, Wdr14, Wdvcf, ESTM55, Gm16314, OTTMUSG00000033458, GNB1L, zgc:110763

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Zebrafish

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184114

Additional Information

Alternative name: WDR14 / GNB1L

Gene ID: GNB1L

UniProt: Q9BYB4

Immunogen: The immunogen for anti-GNB1L antibody: synthetic peptide directed towards the C terminal of human GNB1L

Sequence: RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQR ISLWSLYPRA

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-GNB1L antibody concentration is 1 mg/ml.

Description: GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.This gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders.

Characteristics: Antigen Size: 327 amino acids

Molecular Weight: 36kDa

Synonyms: GY2, FKSG1, WDR14, WDVCF, DGCRK3, KIAA1645, Gbl, AA409454, AI505104, AI851821, 0610033N12Rik, MGC114322, MLST8, GBL, MGC139583, fi37e04, MGC55455, MGC85668, zgc:55455, zgc:85668, wu:fi37e04, Wdr14, Wdvcf, ESTM55, Gm16314, OTTMUSG00000033458, GNB1L, zgc:110763

Application Details

Application Notes: WB Suggested Anti-GNB1L Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GNB1L Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

anti-Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) antibody (Image 2)

anti-Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L) antibody (Image 3)

Publications

Product: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).