Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184212

Chemokine (C-C Motif) Receptor 8 (CCR8) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CC-CKR-8, CCR-8, CDw198, CKRL1, CMKBR8, CMKBRL2, CY6, GPRCY6, TER1, C-C, C-C CKR-8, CKR-8, Cmkbr8, mCCR8
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184212
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8
Sequence MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKM NILGLLIPFT
Predicted Reactivity Human : 100%, Bovine : 93%, Rabbit : 81%
Characteristics This is a rabbit polyclonal antibody against CCR8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CCR8
Background CCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region.
Molecular Weight 41kDa
Gene ID 1237
NCBI Accession NP_005192, NM_005201
UniProt P51685
Research Area Innate Immunity, Chemokines, Receptors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCR8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Haque, Fallon, Pan et al.: "Chemokine receptor-8 (CCR8) mediates human vascular smooth muscle cell chemotaxis and metalloproteinase-2 secretion." in: Blood, Vol. 103, Issue 4, pp. 1296-304, 2004 (PubMed).

Alternatives for antigen "Chemokine (C-C Motif) Receptor 8 (CCR8)", type "Antibodies"
Hosts (70), (15), (3)
Reactivities (80), (19), (15), (12), (12)
Applications (56), (38), (24), (12), (10), (7), (5), (5), (2), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (6), (5), (5), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon