Chemokine (C-C Motif) Receptor 8 (CCR8) (Middle Region) antibody

Details for Product No. ABIN184212
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CC-CKR-8, CCR-8, CDw198, CKRL1, CMKBR8, CMKBRL2, CY6, GPRCY6, TER1, C-C, C-C CKR-8, CKR-8, Cmkbr8, mCCR8
Epitope
Middle Region
(6), (6), (6), (5), (5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Cow (Bovine), Human
(78), (20), (14), (12), (12)
Host
Rabbit
(69), (14), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(54), (37), (25), (11), (10), (5), (5), (4), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184212
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CCR8
Sequence MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKM NILGLLIPFT
Predicted Reactivity Human : 100 %, Bovine : 90 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against CCR8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CCR8
Background CCR8 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. Its gene is located at the chemokine receptor gene cluster region.
Molecular Weight 41 kDa
Gene ID 1237
NCBI Accession NM_005201, NP_005192
UniProt P51685
Research Area Innate Immunity, Chemokines, Receptors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 355 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chemokine (C-C Motif) Receptor 8 (CCR8) (Middle Region) antibody WB Suggested Anti-CCR8 Antibody Titration: 2.5ug/ml
Positive Control: K562 cell lysate
Background publications Haque, Fallon, Pan et al.: "Chemokine receptor-8 (CCR8) mediates human vascular smooth muscle cell chemotaxis and metalloproteinase-2 secretion." in: Blood, Vol. 103, Issue 4, pp. 1296-304, 2004 (PubMed).

Hosts (69), (14), (3)
Reactivities (78), (20), (14), (12), (12)
Applications (54), (37), (25), (11), (10), (5), (5), (4), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (6), (6), (5), (5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
back to top