Serotonin Receptor 1A (HTR1A) antibody
| Antigen | Serotonin Receptor 1A (HTR1A) |
| Synonyms |
Gpcr18, 5HT1A, RAT5HT1A, 5-HT-dro2A, 5-HT1ADro, 5-HT[[1ADro]], 5HT-R2A, 5HT-dro2A, 5HT-drp[[2A]], 5HT[[1ADro]], 5htdro2a, DRO2A, Dm5HTdro2A, d5-HT1A, DmelCG16720, CG16720, htr1a-A, 5-HT1A, HTR1A, 5htr ...
show more
|
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Human |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
 |
1 reference available |
| Catalog no. | ABIN184237 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Gene ID | HTR1A |
| UniProt | P08908 |
| Immunogen | The immunogen for anti-HTR1A antibody: synthetic peptide directed towards the N terminal of human HTR1A |
| Sequence | GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTL IFCAVLGNAC |
| Cross-Reactivity | Human |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-HTR1A antibody concentration is 1 mg/ml. |
| Description | This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity. |
| Characteristics | Antigen Size: 422 amino acids |
| Molecular Weight | 46kDa |
| Synonyms | Gpcr18, 5HT1A, RAT5HT1A, 5-HT-dro2A, 5-HT1ADro, 5-HT[[1ADro]], 5HT-R2A, 5HT-dro2A, 5HT-drp[[2A]], 5HT[[1ADro]], 5htdro2a, DRO2A, Dm5HTdro2A, d5-HT1A, DmelCG16720, CG16720, htr1a-A, 5-HT1A, HTR1A, 5htr1a, 5-HT-1A, htr1a, Htr1a, 5-Ht1a |
Application Details
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Publications
| Product |
Czesak, Lemonde, Peterson et al.: "Cell-specific repressor or enhancer activities of Deaf-1 at a serotonin 1A receptor gene polymorphism." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 26, Issue 6, pp. 1864-71, 2006 (PubMed).
|
Alternatives
Alternatives for antigen "Serotonin Receptor 1A (HTR1A)", type "Antibodies"
| Hosts | Rabbit (20), Goat (3), Mouse (1) |
| Reactivities | Human (12), Rat (Rattus) (10), Mouse (Murine) (6) |
| Applications | Western Blotting (WB) (19), ELISA (11), Immunocytochemistry (ICC) (3), Immunohistochemistry (IHC) (3), Immunofluorescence (IF) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Dot Blot (Dot) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1), Immunoprecipitation (IP) (1) |
| Conjugates | Biotin (1), FITC (1) |
| Epitopes | Internal Region (2), N-Term (2), AA 294-312 (1), C-Term (1), Internal Region,AA 249-262 (1) |
