Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184266

Nanog Homeobox (NANOG) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ENK, ecat4, 2410002E02Rik
Reactivity
»Alternatives Human, Pig (Porcine)
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184266
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NANOG antibody: synthetic peptide directed towards the N terminal of human NANOG
Sequence PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQ DSPDSSTSPK
Cross-Reactivity Human, Pig (Porcine)
Predicted Reactivity Human : 100%, Pig : 92%
Characteristics Antigen Size: 305 amino acids
Purification Affinity Purified
Alternative Name NANOG
Background NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
Molecular Weight 35kDa
Gene ID NANOG
UniProt Q6NSW7
Application Notes WB Suggested Anti-NANOG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-NANOG antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Piestun, Kochupurakkal, Jacob-Hirsch et al.: "Nanog transforms NIH3T3 cells and targets cell-type restricted genes." in: Biochemical and biophysical research communications, Vol. 343, Issue 1, pp. 279-85, 2006 (PubMed).

Alternatives for antigen "Nanog Homeobox (NANOG)", type "Antibodies"
Hosts (101), (38), (14), (3)
Reactivities (132), (39), (19), (15), (3), (2), (1), (1)
Applications (131), (84), (38), (32), (22), (14), (13), (10), (6), (6), (1)
Conjugates (7), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (11), (9), (6), (6), (5), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon