Transcription Elongation Factor B (SIII), Polypeptide 3 (110kDa, Elongin A) (TCEB3) antibody

Antigen: Transcription Elongation Factor B (SIII), Polypeptide 3 (110kDa, Elongin A) (TCEB3)

Synonyms: SIII, TCEB3A, FLJ38760, FLJ42849, 110kDa, Tceb3a, AA408125, dEloA, DmelCG6755, CG6755, tceb3a, zgc:56638, wu:fw66g10, TCEB3, MGC157191

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN184283

Additional Information

Alternative name: TCEB3

Gene ID: TCEB3

UniProt: Q14241

Immunogen: The immunogen for anti-TCEB3 antibody: synthetic peptide directed towards the C terminal of human TCEB3

Sequence: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTI KAFKNRFSRR

Cross-Reactivity: Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-TCEB3 antibody concentration is 1 mg/ml.

Description: Elongin A (TCEB3), which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits.This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.

Characteristics: Antigen Size: 772 amino acids

Molecular Weight: 87kDa

Application Details

Application Notes: WB Suggested Anti-TCEB3 Antibody Titration: 7.5ug/ml
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TCEB3 Antibody Titration: 7.5ug/ml
Positive Control: Transfected 293T

anti-Transcription Elongation Factor B (SIII), Polypeptide 3 (110kDa, Elongin A) (TCEB3) antibody (Image 2)

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).