Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184283

Transcription Elongation Factor B (SIII), Polypeptide 3 (110kDa, Elongin A) (TCEB3) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EloA, SIII, SIII p110, TCEB3A, 110kDa, Tceb3a, AA408125, El, CG6755, Dmel\\CG6755, Elo-A, dEloA, tceb3a, zgc:56638, wu:fw66g10, TCEB3
Reactivity
»Alternatives Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184283
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCEB3 antibody: synthetic peptide directed towards the C terminal of human TCEB3
Sequence AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTI KAFKNRFSRR
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Dog : 100%, Chicken : 92%, Rat : 92%, Guinea pig : 91%
Characteristics Antigen Size: 772 amino acids
Purification Protein A purified
Alternative Name TCEB3
Background Elongin A (TCEB3), which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits.This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation.
Molecular Weight 87kDa
Gene ID TCEB3
UniProt Q14241
Application Notes WB Suggested Anti-TCEB3 Antibody Titration: 7.5ug/ml
Positive Control: Transfected 293T.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µl of distilled water
Buffer Final anti-TCEB3 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Transcription Elongation Factor B (SIII), Polypeptide 3 (110kDa, Elongin A) (TCEB3)", type "Antibodies"
Hosts (34), (7), (3)
Reactivities (44), (19), (17), (12), (12)
Applications (32), (14), (10), (7), (6), (4), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (4), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon