Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184293

Transcription Factor 12 (TCF12) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CRS3, HEB, HTF4, HsT17266, bHLHb20, SCBPA, zgc:85956, wu:fb74g05, wu:fc43e06, zgc:110341, A130037E08Rik, ALF1, HEBAlt, HTF-4, ME1, REB, TCF12
Reactivity
»Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN184293
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12
Sequence QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGS SQFSGSGIDE
Cross-Reactivity Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Zebrafish : 92%
Characteristics Antigen Size: 706 amino acids
Purification Affinity Purified
Alternative Name TCF12
Background TCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins.The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Molecular Weight 73kDa
Gene ID TCF12
UniProt Q99081
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes WB Suggested Anti-TCF12 Antibody Titration: 0.06ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-TCF12 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Zhang, Kalkum, Yamamura et al.: "E protein silencing by the leukemogenic AML1-ETO fusion protein." in: Science (New York, N.Y.), Vol. 305, Issue 5688, pp. 1286-9, 2004 (PubMed).

Wissmüller, Kosian, Wolf et al.: "The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors." in: Nucleic acids research, Vol. 34, Issue 6, pp. 1735-44, 2006 (PubMed).

Alternatives for antigen "Transcription Factor 12 (TCF12)", type "Antibodies"
Hosts (38), (4)
Reactivities (42), (24), (24), (3), (2), (1), (1), (1), (1), (1), (1)
Applications (33), (19), (10), (10), (4), (4), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (2), (2), (2), (1), (1), (1), (1)
Beacon