Transcription Factor 12 (TCF12) antibody

Antigen: Transcription Factor 12 (TCF12)

Synonyms: HEB, HTF4, bHLHb20, HsT17266, SCBPA, TCF12, zgc:85956, wu:fb74g05, wu:fc43e06, zgc:110341, MGC142325

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN184293

Additional Information

Alternative name: TCF12

Gene ID: TCF12

UniProt: Q99081

Immunogen: The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12

Sequence: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGS SQFSGSGIDE

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TCF12 antibody concentration is 1 mg/ml.

Description: TCF12 encodes a protein that is a member of the basic helix-loop-helix (bHLH) E-protein family which recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins.The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Characteristics: Antigen Size: 706 amino acids

Molecular Weight: 73kDa

Application Details

Application Notes: WB Suggested Anti-TCF12 Antibody Titration: 0.06ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-TCF12 Antibody Titration: 0.06ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung

Publications

Wissmüller, Kosian, Wolf et al.: "The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors." in: Nucleic acids research, Vol. 34, Issue 6, pp. 1735-44, 2006 (PubMed).

Product: Zhang, Kalkum, Yamamura et al.: "E protein silencing by the leukemogenic AML1-ETO fusion protein." in: Science (New York, N.Y.), Vol. 305, Issue 5688, pp. 1286-9, 2004 (PubMed).