Glial Cells Missing Homolog 1 (Drosophila) (GCM1) antibody

Antigen: Glial Cells Missing Homolog 1 (Drosophila) (GCM1)

Synonyms: GCMA, hGCMa, GCMa, glide, Gcm-rs2, Gcm1-rs1, GCM1, GCM, GCM-1

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN184316

Additional Information

Alternative name: GCM1 / GCMA

Gene ID: GCM1

UniProt: Q9NP62

Immunogen: The immunogen for anti-GCM1 antibody: synthetic peptide directed towards the C terminal of human GCM1

Sequence: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKW DFEEEMTYLG

Cross-Reactivity: Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GCM1 antibody concentration is 1 mg/ml.

Description: GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.

Characteristics: Antigen Size: 436 amino acids

Molecular Weight: 49kDa

Application Details

Application Notes: WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Chuang, Chang, Chang et al.: "Histone deacetylase 3 binds to and regulates the GCMa transcription factor." in: Nucleic acids research, Vol. 34, Issue 5, pp. 1459-69, 2006 (PubMed).