Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184316

Glial Cells Missing Homolog 1 (Drosophila) (GCM1) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GCMA, hGCMa, GCMa, glide, Gcm-rs2, Gcm1-rs1, Gcma, GCM1, GCM, GCM-1
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184316
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GCM1 antibody: synthetic peptide directed towards the C terminal of human GCM1
Sequence DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKW DFEEEMTYLG
Cross-Reactivity Dog (Canine), Human
Predicted Reactivity Human : 100%, Horse : 92%, Dog : 90%, Rabbit : 81%
Characteristics Antigen Size: 436 amino acids
Purification Affinity Purified
Alternative Name GCM1 / GCMA
Background GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins.
Molecular Weight 49kDa
Gene ID GCM1
UniProt Q9NP62
Application Notes WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-GCM1 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Chuang, Chang, Chang et al.: "Histone deacetylase 3 binds to and regulates the GCMa transcription factor." in: Nucleic acids research, Vol. 34, Issue 5, pp. 1459-69, 2006 (PubMed).

Alternatives for antigen "Glial Cells Missing Homolog 1 (Drosophila) (GCM1)", type "Antibodies"
Hosts (20), (11)
Reactivities (27), (17), (13), (13), (12), (12)
Applications (21), (14), (10), (9), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (1), (1), (1), (1)
Beacon