Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184330

General Transcription Factor IIE, Polypeptide 1, alpha 56kDa (GTF2E1) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
FE, 56kDa, TFIIE-A, AI303800, 2610024P03Rik, TF2E1, GTF2E2, DDBDRAFT_0168201, DDBDRAFT_0168202, DDBDRAFT_0231096, DDB_0168201, DDB_0168202, DDB_0231096, DDBDRAFT_0217176, DDBDRAFT_0217177, DDBDRAFT_02 ... show more
Reactivity
»Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Fruit Fly (Drosophila melanogaster)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184330
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GTF2E1 antibody: synthetic peptide directed towards the C terminal of human GTF2E1
Sequence VADDPIVMVAGRPFSYSEVSQRPELVAQMTPEEKEAYIAM GQRMFEDLFE
Cross-Reactivity Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, African clawed frog : 85%
Characteristics Antigen Size: 439 amino acids
Purification Affinity Purified
Alternative Name GTF2E1 / TF2E1
Background The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation together with RNA polymerase II and other general factors. Human TFIIE consists of two subunits of relative molecular mass 57,000 (TFIIE-alpha) and 34,000 (TFIIE-beta) and joins the preinitiation complex after RNA polymerase II and TFIIF. TFIIE-alpha is necessary for transcription initiation together with TFIIE-beta, and recombinant TFIIE-alpha can fully replace the natural subunit in an in vitro transcription assay. Its sequence contains several interesting structural motifs (leucine repeat, zinc finger and helix-turn-helix) and sequence similarities to bacterial sigma factors that suggest direct involvement in the regulation of transcription initiation
Molecular Weight 49kDa
Gene ID GTF2E1
UniProt P29083
Application Notes WB Suggested Anti-GTF2E1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Daudi cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-GTF2E1 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Ohkuma, Sumimoto, Hoffmann et al.: "Structural motifs and potential sigma homologies in the large subunit of human general transcription factor TFIIE." in: Nature, Vol. 354, Issue 6352, pp. 398-401, 1992 (PubMed).

Alternatives for antigen "General Transcription Factor IIE, Polypeptide 1, alpha 56kDa (GTF2E1)", type "Antibodies"
Hosts (8), (8)
Reactivities (16), (1), (1), (1), (1), (1), (1), (1)
Applications (13), (4), (4), (3), (2), (1), (1), (1)
Epitopes (4), (3), (3), (2), (1), (1)
Beacon