Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Parathyroid Hormone (PTH) (AA 1-38) antibody

Antigen

Parathyroid Hormone (PTH)

Synonyms PTH1, Pthp, MGC117651, Pth1, Pthr1, PTH-(1-84), PTH
Epitope
Alternatives

AA 1-38

Clonality Monoclonal (A1-64)
Host
Alternatives

Mouse

Reactivity
Alternatives

Human

Application
Alternatives Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA)
Catalog no. ABIN191956
Quantity 10 µg  (Variants)
Price 195.00 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 7 to 10 Business Days

Additional Information

Characteristics Synonyms: Parathormone, Parathyrin
Alternative name Parathyroid hormone / PTH
Swiss-Prot P01270
Immunogen Synthetic human PTH (aa 1-38) poly Lysin conjugatedAA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG
Cross-Reactivity Human
Isotype IgG1  (Matching secondary antibodies)
Clone A1-64
Specificity This antibody detects PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic PTH (aa 1-3, 1-10, 4-16, 28-48,39-84, 44-68, 53-84,), PTHrP (aa 1- 86). Species: Human. Others not tested. Add. Information: LocusID 5741

Application Details

Application Notes RIA (25 ng/ml). Immunohistochemistry (cryo-sections and paraffinsections, 2 ug/ml). ELISA (1 ug/ml). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Purification Purified
Buffer 50 mM TRIS pH 7,4, NaN3 0.05 %Reconstitution: Restore in aqua bidest to 1 mg/ml.
Storage Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing. Shelf life: One year from despatch.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Parathyroid Hormone (PTH)", type "Antibodies"
Hosts Mouse (63), Rabbit (27), Goat (6), Rat (2), Sheep (2)
Reactivities Human (88), Rat (Rattus) (2)
Applications Enzyme Immunoassay (EIA) (53), Radioimmunoassay (RIA) (34), ELISA (27), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (16), Immunohistochemistry (Frozen Sections) (IHC (fro)) (14), Western Blotting (WB) (14), Immunohistochemistry (IHC) (6), Dot Blot (Dot) (2), ELISA (Detection) (1)
Conjugates Biotin (2)
Epitopes AA 1-38 (17), AA 1-34 (13), AA 1-10 (10), AA 32-155 (9), AA 44-68 (4), AA 28-48 (2), N-Term AA 1-34 (2), AA 32-116 (1), Amino Acids 15-25 (1), amino acids 53-68 (1), amino acids 53-84 (1)