Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309627

Zinc Finger Protein 545 (ZNF545) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF545
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN309627
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF545 antibody: synthetic peptide directed towards the C terminal of human ZNF545
Sequence KAFSRYSQLISHQSIHIGVKPYDCKECGKAFRLLSQLTQH QSIHIGEKPY
Predicted Reactivity Rat :100%,   Mouse :100%,   Crab-eating macaque :100%,   Human :100%,   Bovine :84%,  
Characteristics This is a rabbit polyclonal antibody against ZNF545. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF545
Background ZNF545 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 63kDa
Gene ID 284406
NCBI Accession NP_597723, NM_133466
UniProt Q8N141
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF545 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Alternatives for antigen "Zinc Finger Protein 545 (ZNF545)", type "Antibodies"
Hosts (7), (1)
Reactivities (8), (2), (2), (2), (1)
Applications (8), (1), (1)
Epitopes (4), (3), (2), (1), (1)
Beacon