Zinc Finger Protein 545 (ZNF545) antibody

Antigen: Zinc Finger Protein 545 (ZNF545)

Synonyms: ZNF545, KIAA1948, MGC45380

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN309627

Additional Information

Alternative name: ZNF545

Gene ID: ZNF545

UniProt: Q8N141

Immunogen: The immunogen for anti-ZNF545 antibody: synthetic peptide directed towards the C terminal of human ZNF545

Sequence: KAFSRYSQLISHQSIHIGVKPYDCKECGKAFRLLSQLTQH QSIHIGEKPY

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF545 antibody concentration is 1 mg/ml.

Description: ZNF545 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Characteristics: Antigen Size: 532 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-ZNF545 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF545 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Publications

Product: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).