Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 11 (PSMD11) antibody

Antigen: Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 11 (PSMD11)

Synonyms: psmd11, zgc:56580, zgc:77763, wu:fb55b06, PSMD11, MGC137609

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN309652

Additional Information

Alternative name: PSMD11

Gene ID: PSMD11

UniProt: O00231

Immunogen: The immunogen for anti-PSMD11 antibody: synthetic peptide directed towards the N terminal of human PSMD11

Sequence: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDE EAVQVKEQSI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-PSMD11 antibody concentration is 1 mg/ml.

Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator.The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 422 amino acids

Molecular Weight: 47kDa

Application Details

Application Notes: WB Suggested Anti-PSMD11 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin, Proteasome

Restrictions: For Research Use only

Images

WB Suggested Anti-PSMD11 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).