Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6) antibody

Antigen

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6)
Synonyms S10, Rpn7, p44S10, KIAA0107, SGA-113M
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN309656
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name PSMD6
Gene ID PSMD6
UniProt Q15008
Immunogen The immunogen for anti-PSMD6 antibody: synthetic peptide directed towards the N terminal of human PSMD6
Sequence YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEK NLGESEIRDA
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-PSMD6 antibody concentration is 1 mg/ml.
Description PSMD6 acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Characteristics Antigen Size: 389 amino acids
Molecular Weight 45kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-PSMD6 Antibody Titration: 2.5ug/ml
Positive Control: Transfected 293T.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Proteolysis / Ubiquitin, Proteasome
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 6 (PSMD6)", type "Antibodies"
Hosts Rabbit (27), Mouse (1)
Reactivities Human (27), Mouse (Murine) (23), Rat (Rattus) (23), Cow (Bovine) (20), Horse (Equine) (18), Pig (Porcine) (18), Rabbit (18), Dog (Canine) (2), Xenopus laevis (2), Zebrafish (2)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (12), ELISA (10), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (2)