Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309679

REX4, RNA Exonuclease 4 Homolog (S. Cerevisiae) (REXO4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms REX4, XPMC2, XPMC2H, Gm111, Xpmc2h, xpmc2, REXO4, im:7156740
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309679
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-REXO4 antibody: synthetic peptide directed towards the middle region of human REXO4
Sequence PADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGL TRALALDCEM
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against REXO4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name REXO4
Background The regulation of the quinone reductase (QR) gene as well as other genes involved in detoxification is known to be mediated by an electrophile response element (EpRE). QR gene regulation by the antiestrogen-occupied estrogen receptor (ER) is mediated by the EpRE-containing region of the human QR gene, and the ER is one of the complex of proteins that binds to the EpRE. REXO4 directly binds to the EpRE and interacts with the ER. The activation of QR gene activity by REXO4 is enhanced in the presence of ER beta.
Molecular Weight 47kDa
Gene ID 57109
NCBI Accession NP_065118, NM_020385
UniProt Q9GZR2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-REXO4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "REX4, RNA Exonuclease 4 Homolog (S. Cerevisiae) (REXO4)", type "Antibodies"
Hosts (10), (1)
Reactivities (12), (3), (3), (1), (1)
Applications (11), (4), (2), (2)
Epitopes (2), (2), (1), (1), (1)
Beacon