Ring Finger Protein 138 (RNF138) (C-Term) antibody

Details for Product No. ABIN309683
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HSD-4, NARF, STRIN, hNARF, 2410015A17Rik, 2810480D20Rik, Trif, Trif-d, Rsd4, narf
Epitope
C-Term
(2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(23), (20), (20), (13), (12), (12)
Host
Rabbit
(26)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (10), (10), (3)
Pubmed 1 reference available
Catalog no. ABIN309683
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RNF138
Sequence LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYG EFVNLQLDEE
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against RNF138. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RNF138
Background RNF138 contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions.The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Molecular Weight 28 kDa
Gene ID 51444
NCBI Accession NM_016271, NP_057355
UniProt Q8WVD3
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Proteolysis / Ubiquitin, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 245 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Yamada, Ohnishi, Ohkawara et al.: "NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF)." in: The Journal of biological chemistry, Vol. 281, Issue 30, pp. 20749-60, 2006 (PubMed).

Hosts (26)
Reactivities (23), (20), (20), (13), (12), (12)
Applications (14), (10), (10), (3)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1)
back to top