Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309683

Ring Finger Protein 138 (RNF138) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSD-4, NARF, STRIN, hNARF, 2410015A17Rik, 2810480D20Rik, Trif, Trif-d, Rsd4, narf
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309683
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RNF138 antibody: synthetic peptide directed towards the C terminal of human RNF138
Sequence LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYG EFVNLQLDEE
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Rat : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against RNF138. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RNF138
Background RNF138 contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions.The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Molecular Weight 28kDa
Gene ID 51444
NCBI Accession NP_057355, NM_016271
UniProt Q8WVD3
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Proteolysis / Ubiquitin, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RNF138 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yamada, Ohnishi, Ohkawara et al.: "NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF)." in: The Journal of biological chemistry, Vol. 281, Issue 30, pp. 20749-60, 2006 (PubMed).

Alternatives for antigen "Ring Finger Protein 138 (RNF138)", type "Antibodies"
Hosts (27), (4)
Reactivities (28), (18), (18), (13), (12), (12)
Applications (19), (11), (10), (3), (2)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (2), (2), (1), (1)
Beacon