Zinc Finger and SCAN Domain Containing 20 (ZSCAN20) antibody

Antigen: Zinc Finger and SCAN Domain Containing 20 (ZSCAN20)

Synonyms: KOX29, ZNF31, ZFP-31, ZNF360, Zfp31, MGC30798, Zkscan20, C130001F22, ZSCAN20, RGD1562996

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN309697

Additional Information

Alternative name: ZSCAN20

Gene ID: ZSCAN20

UniProt: P17040

Immunogen: The immunogen for anti-ZSCAN20 antibody: synthetic peptide directed towards the middle region of human ZSCAN20

Sequence: QESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFSRSSHF IAHQRIHTGE

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZSCAN20 antibody concentration is 1 mg/ml.

Description: ZSCAN20 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers and 1 SCAN box domain. ZSCAN20 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 1043 amino acids

Molecular Weight: 117kDa

Application Details

Application Notes: WB Suggested Anti-ZSCAN20 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZSCAN20 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Jordanova, Irobi, Thomas et al.: "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy." in: Nature genetics, Vol. 38, Issue 2, pp. 197-202, 2006 (PubMed).