Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) antibody

Antigen: Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3)

Synonyms: CAR, CAR1, MB67, MGC97144, MGC97209, MGC150433, Care2, ESTM32, AA209988, AI551208, CAR-beta, MGC107281, MGC108525, NR1I3, CXR

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN309705

Additional Information

Alternative name: NR1I3 / CAR

Gene ID: NR1I3

UniProt: Q5VTW5

Immunogen: The immunogen for anti-NR1I3 antibody: synthetic peptide directed towards the C terminal of human NR1I3

Sequence: FHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQL QEEMALTLQS

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-NR1I3 antibody concentration is 1 mg/ml.

Description: NR1I3 is a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members.

Characteristics: Antigen Size: 348 amino acids

Molecular Weight: 40kDa

Application Details

Application Notes: WB Suggested Anti-NR1I3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NR1I3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Ferguson, Chen, LeCluyse et al.: "Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha." in: Molecular pharmacology, Vol. 68, Issue 3, pp. 747-57, 2005 (PubMed).