Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309724

Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARTD17, PARP-6-B1, PARP-6-C, pART17, 1700119G14Rik, 2310028P13Rik, 3110038K10Rik, C030013N01Rik, PARP-6, RGD1310937
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN309724
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PARP6 antibody: synthetic peptide directed towards the C terminal of human PARP6
Sequence KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTF AFHGSHIENW
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against PARP6. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name PARP6
Background Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
Molecular Weight 59kDa
Gene ID 56965
NCBI Accession NP_064599, NM_020214
UniProt Q2NL67
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PARP6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6)", type "Antibodies"
Hosts (23)
Reactivities (21), (3), (3), (1), (1), (1)
Applications (23), (6), (1), (1)
Epitopes (11), (4), (2), (2), (2)
Beacon