Did you know that you can buy products from over 140 different suppliers from us?

Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) (C-Term) antibody

Details for Product No. ABIN309724
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARTD17, PARP-6-B1, PARP-6-C, pART17, 1700119G14Rik, 2310028P13Rik, 3110038K10Rik, C030013N01Rik, PARP-6, RGD1310937
Epitope
C-Term
(12), (8), (4)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(23), (3), (3), (1), (1), (1)
Host
Rabbit
(25)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(25), (12), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309724
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PARP6
Sequence KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTF AFHGSHIENW
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against PARP6. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name PARP6
Background Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.
Molecular Weight 59 kDa
Gene ID 56965
NCBI Accession NM_020214, NP_064599
UniProt Q2NL67
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 519 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) (C-Term) antibody WB Suggested Anti-PARP6 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) (C-Term) antibody (2) anti-Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6) (C-Term) antibody (Image 2)
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309724
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top