Recombination Signal Binding Protein For Immunoglobulin kappa J Region-Like (RBPJL) antibody

Antigen: Recombination Signal Binding Protein For Immunoglobulin kappa J Region-Like (RBPJL)

Synonyms: SUH, SUHL, RBP-L, RBPSUHL, Rbpsuhl, RBPJL, rbpsuhl

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN309728

Additional Information

Alternative name: RBPJL

Gene ID: RBPJL

UniProt: Q5QPV0

Immunogen: The immunogen for anti-RBPJL antibody: synthetic peptide directed towards the N terminal of human RBPJL

Sequence: AHQAGETGPTVCGYMGLDSASGSATETQKLNFEQQPDSRE FGCAKTLYIS

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-RBPJL antibody concentration is 1 mg/ml.

Description: In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPSUHL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). The protein encoded by this gene is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.

Characteristics: Antigen Size: 517 amino acids

Molecular Weight: 57kDa

Application Details

Application Notes: WB Suggested Anti-RBPJL Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RBPJL Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Beres, Masui, Swift et al.: "PTF1 is an organ-specific and Notch-independent basic helix-loop-helix complex containing the mammalian Suppressor of Hairless (RBP-J) or its paralogue, RBP-L." in: Molecular and cellular biology, Vol. 26, Issue 1, pp. 117-30, 2005 (PubMed).