Zinc Finger Protein 498 (ZNF498) antibody

Antigen: Zinc Finger Protein 498 (ZNF498)

Synonyms: ZSCAN25, ZNF498

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309738

Additional Information

Alternative name: ZNF498

Gene ID: ZNF498

UniProt: Q14C99

Immunogen: The immunogen for anti-ZNF498 antibody: synthetic peptide directed towards the middle region of human ZNF498

Sequence: QIDCFGEYVEPQDCRVSPGGGSKEKEAKPPQEDLKGALVA LTSERFGEAS

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF498 antibody concentration is 1 mg/ml.

Description: The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Alternative splicing results in two transcript variants encoding different proteins. Additional splice variants have been identified, but their biological validity has not been determinedThis gene encodes a protein of unknown function. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions.

Characteristics: Antigen Size: 310 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-ZNF498 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF498 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

anti-Zinc Finger Protein 498 (ZNF498) antibody (Image 2)

Publications

Product: Laity, Lee, Wright: "Zinc finger proteins: new insights into structural and functional diversity." in: Current opinion in structural biology, Vol. 11, Issue 1, pp. 39-46, 2001 (PubMed).

Demena, Abdulkadir, Jorge: "Radioiodine treatment of hyperthyroidism at the Tikur Anbessa Hospital." in: Ethiopian medical journal, Vol. 39, Issue 1, pp. 39-46, 2001 (PubMed).