Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ventral Anterior Homeobox 1 (VAX1) antibody

Antigen

Ventral Anterior Homeobox 1 (VAX1)

Synonyms MGC126743, MGC126745
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN309739
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name VAX1
Gene ID Vax1
UniProt B1AVW5
Immunogen The immunogen for anti-Vax1 antibody: synthetic peptide directed towards the N terminal of human Vax1
Sequence MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLP AAFLKEPQGA
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-Vax1 antibody concentration is 1 mg/ml.
Description VAX1 is a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. It may play an important role in the development of anterior ventral forebrain and visual system.This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-180 AK127095.1 1-180 181-201 AL731557.7 35785-35805 c 202-1186 AK127095.1 199-1183 1187-4494 AL731557.7 26205-29512 c
Characteristics Antigen Size: 186 amino acids
Molecular Weight 21kDa

Application Details

Application Notes WB Suggested Anti-Vax1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Neurology
Restrictions For Research Use only

Publications

Product Holland, Booth, Bruford: "Classification and nomenclature of all human homeobox genes." in: BMC biology, Vol. 5, pp. 47, 2008 (PubMed).

Alternatives

Alternatives for antigen "Ventral Anterior Homeobox 1 (VAX1)", type "Antibodies"
Hosts Rabbit (29)
Reactivities Mouse (Murine) (27), Human (26), Rat (Rattus) (24), Cow (Bovine) (21), Dog (Canine) (21), Chicken (20), Pig (Porcine) (18), Cat (Feline) (1), Xenopus laevis (1), Zebrafish (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (14), ELISA (10), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (4)