Did you know that you can buy products from over 140 different suppliers from us?

Kelch-Like 25 (Drosophila) (KLHL25) (N-Term) antibody

Details for Product No. ABIN309746
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms klhl25, MGC147232, 2810402K13Rik, BC027373, Enc-1, ENC-2, ENC2, RGD1310815, Xencr-2, encr-2
Epitope
N-Term
(14), (8), (7), (4), (2), (2), (2), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Xenopus laevis, Human, Chicken
(44), (2), (2), (1), (1)
Host
Rabbit
(19), (16), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(44), (31), (7), (4), (1), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309746
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KLHL25
Sequence RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDEL ETEDERVVFE
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Human : 100 %, Bovine : 90 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against KLHL25. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name KLHL25
Background KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein
Molecular Weight 66 kDa
Gene ID 64410
NCBI Accession NM_022480, NP_071925
UniProt Q9H0H3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 589 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kelch-Like 25 (Drosophila) (KLHL25) (N-Term) antibody WB Suggested Anti-KLHL25 Antibody Titration: 0.3125ug/ml
Positive Control: Jurkat cell lysate
anti-Kelch-Like 25 (Drosophila) (KLHL25) (N-Term) antibody (2) anti-Kelch-Like 25 (Drosophila) (KLHL25) (N-Term) antibody (Image 2)
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
back to top