Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309746

Kelch-Like 25 (Drosophila) (KLHL25) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ENC-2, ENC2, 2810402K13Rik, BC027373, Enc-1, RGD1310815, Xencr-2, encr-2, klhl25, MGC147232
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN309746
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25
Sequence RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDEL ETEDERVVFE
Predicted Reactivity Chicken : 100%, Dog : 100%, Human : 100%, Bovine : 92%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against KLHL25. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name KLHL25
Background KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein
Molecular Weight 66kDa
Gene ID 64410
NCBI Accession NP_071925, NM_022480
UniProt Q9H0H3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KLHL25 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Kelch-Like 25 (Drosophila) (KLHL25)", type "Antibodies"
Hosts (11), (9), (9)
Reactivities (29), (2), (2), (1), (1)
Applications (28), (18), (5), (3), (1), (1)
Epitopes (9), (4), (2), (2), (2), (1), (1)
Beacon