Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Kelch-Like 25 (Drosophila) (KLHL25) antibody

Antigen

Kelch-Like 25 (Drosophila) (KLHL25)

Synonyms ENC2, ENC-2, FLJ12587, FLJ45015, klhl25, encr-2, Xencr-2, MGC147232, Enc-1, BC027373, MGC36331, 2810402K13Rik, MGC116251, RGD1310815
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Chicken, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
2 references available
Catalog no. ABIN309746
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Kelch-like protein 25
Gene ID KLHL25
UniProt Q9H0H3
Immunogen The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25
Sequence RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDEL ETEDERVVFE
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-KLHL25 antibody concentration is 1 mg/ml.
Description KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein
Characteristics Antigen Size: 589 amino acids
Molecular Weight 66kDa

Application Details

Application Notes WB Suggested Anti-KLHL25 Antibody Titration: 0.3125ug/ml
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Alternatives

Alternatives for antigen "Kelch-Like 25 (Drosophila) (KLHL25)", type "Antibodies"
Hosts Rabbit (23), Chicken (4), Mouse (4)
Reactivities Human (31), Mouse (Murine) (19), Rat (Rattus) (19), Dog (Canine) (18), Chicken (1)
Applications Western Blotting (WB) (16), Immunofluorescence (IF) (14), ELISA (11), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (3), Internal Region (1), Middle Region (1)