Zinc Finger Protein 432 (ZNF432) antibody

Antigen: Zinc Finger Protein 432 (ZNF432)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN309796

Additional Information

Alternative name: ZNF432

Gene ID: ZNF432

UniProt: O94892

Immunogen: The immunogen for anti-ZNF432 antibody: synthetic peptide directed towards the N terminal of human ZNF432

Sequence: GKSFLHGNYEELYSAAKFSVSTKANSTKSQVSKHQRTHEI EKNHVCSECG

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF432 antibody concentration is 1 mg/ml.

Description: ZNF432 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF432 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 652 amino acids

Molecular Weight: 75kDa

Application Details

Application Notes: WB Suggested Anti-ZNF432 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF432 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Zhan, Desiderio: "Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry." in: Analytical biochemistry, Vol. 354, Issue 2, pp. 279-89, 2006 (PubMed).