Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 548 (ZNF548) (N-Term) antibody

Details for Product No. ABIN309813
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(2), (1), (1)
Reactivity
Human
(6)
Host
Rabbit
(5), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309813
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF548
Sequence VHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTE DREAFQTGQN
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF548. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF548
Background ZNF548 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF548 may be involved in transcriptional regulation.
Molecular Weight 63 kDa
Gene ID 147694
NCBI Accession NM_152909, NP_690873
UniProt Q8NEK5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 533 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (5), (1)
Reactivities (6)
Applications (6), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309813
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top